PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family LBD
Protein Properties Length: 224aa    MW: 24730.1 Da    PI: 8.4753
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-12380PU_refplantGDBView CDS
gnl|UG|Lsa#S58676784PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.7e-42421411100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ael+++++e
  Lsa008990  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQSLQAELNAVRAE 141
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.64341142IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-4242139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRDID ASYQLGRRHM LGLPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKLLMEV PENQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQHQVQS LQAELNAVRA EILRYKYTET HHDHHIIPSH HLALFSTGAV PVTTPPPPPP  180
PPSPLPPPPP PPPPPASSSS SMYTPPSTTT DYSTITNDNV SYFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279029.11e-117PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T53e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7T4G01e-117D7T4G0_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g02380.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-83LOB domain-containing protein 15